Overview

  • Product name
    Recombinant Human SNRPG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSKAHPPELKKFMDKKLSLKLNGGRHVQGI LRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 76
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105596 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 50% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • MGC117317
    • RUXG_HUMAN
    • Sm protein G
    • Sm-G
    • Small nuclear ribonucleoprotein G
    • Small nuclear ribonucleoprotein polypeptide G
    • SmG
    • snRNP-G
    • SNRPG
    see all
  • Function
    Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.
  • Sequence similarities
    Belongs to the snRNP Sm proteins family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab105596.

References

ab105596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up