Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLH RREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNL LQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSSFSNG CPGEGPRFSAPRRLSTSSLRHPSLGEESTHALIAPDEQSHTYVNTPASED DHRRGRHCLQPLPEGQAPFLPQARGPDQRDPQVFLQPGQVKFVLGPTPAR RHMVKCQGLCPSLHDPPHHNNNNEAPSECPAQPKCTYENVTGGLWRGAGW RLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSR DGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVF NFDFRRPGPEPPRQLNYIQVELKGWGGDRPKGPQNPSSPQAPMPTTHPAR SSDSYAVIDLKKTVAMSNLQRALPRDDGTARKTRHNSTDLPL
    • Amino acids
      1 to 492
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FGFR signalling adaptor SNT2
    • FGFR substrate 3
    • Fibroblast growth factor receptor substrate 3
    • FRS2 beta
    • FRS2B
    • FRS3
    • FRS3 protein
    • MGC17167
    • SNT 2
    • Suc1 associated neurotrophic factor target 2
    • Suc1 associated neurotrophic factor target 2 (FGFR signalling adaptor)
    see all
  • Relevance
    SNT2 is a substrate for the fibroblast growth factor receptor. It functions in linking FGF receptor stimulation to activators of Ras.
  • Cellular localization
    Plasma membrane

Images

  • ab161169 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161169 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up