Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      VRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILS VNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV
    • Amino acids

      116 to 210
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Syntrophin like
    • 59 kDa dystrophin associated protein A1 basic component 2
    • 59 kDa dystrophin-associated protein A1 basic component 2
    • Basic beta 2 syntrophin
    • Beta 2 syntrophin
    • Beta-2-syntrophin
    • D16S2531E
    • Dystrophin associated protein A1 59kD basic component 2
    • EST25263
    • SNT2B2
    • SNT3
    • Sntb2
    • SNTB2_HUMAN
    • SNTL
    • Syntrophin 3
    • Syntrophin beta 2 (dystrophin associated protein A1 59kDa basic component 2)
    • Syntrophin-3
    • Syntrophin-like
    see all
  • Function

    Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. May play a role in the regulation of secretory granules via its interaction with PTPRN.
  • Tissue specificity

    Ubiquitous. Isoform 1 is the predominant isoform. Weak level of isoform 2 is present in all tested tissues, except in liver and heart where it is highly expressed.
  • Sequence similarities

    Belongs to the syntrophin family.
    Contains 1 PDZ (DHR) domain.
    Contains 2 PH domains.
    Contains 1 SU (syntrophin unique) domain.
  • Domain

    The PH 1 domain mediates the oligomerization in a calcium dependent manner.
    The PDZ domain binds to the last three or four amino acids of ion channels and receptor proteins. The association with dystrophin or related proteins probably leaves the PDZ domain available to recruit proteins to the membrane.
    The SU domain binds calmodulin in a calcium-dependent manner.
  • Post-translational
    modifications

    Phosphorylated. Partially dephosphorylated upon insulin stimulation.
  • Cellular localization

    Membrane. Cytoplasmic vesicle > secretory vesicle membrane. Cell junction. Cytoplasm > cytoskeleton. Membrane-associated. In muscle, it is exclusively localized at the neuromuscular junction (By similarity). In insulinoma cell line, it is enriched in secretory granules.
  • Information by UniProt

Images

  • ab159558 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up