Overview

  • Product name

    Recombinant Human SNX10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCV RRRYREFVWLRQRLQSNALLVQLPELPSKNLFFNMNNRQHVDQRRQGLED FLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKFA LMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQE S
    • Molecular weight

      48 kDa including tags
    • Amino acids

      1 to 201

Specifications

Our Abpromise guarantee covers the use of ab131943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2410004M09Rik
    • MGC109202
    • MGC33054
    • OPTB8
    • SNX10
    • SNX10_HUMAN
    • Sorting nexin 10
    • Sorting nexin-10
    see all
  • Function

    May be involved in several stages of intracellular trafficking (By similarity). May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles.
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
  • Domain

    The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3-phosphate.
  • Cellular localization

    Cytoplasm. Endosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab131943 at approximately 47.85 kDa.
    Stained with Coomassie Blue.

References

ab131943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up