Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWK RYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGA EDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLHILPPPLIPTPP PDDPRLSQLLPAERRGLEELEVPVDPPPSSPAQEALDLLFNCESTEEASG SPARGPLTEAELALFDPFSKEEGAAPSPTHVAELATMEVESARLDQEPWE PGGQEEEEDGEGGPTPAYLSQATELITQALRDEKAGAYAAALQGYRDGVH VLLQGVPSDPLPARQEGVKKKAAEYLKRAEEILRLHLSQLPP
    • Amino acids

      1 to 342
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Clone iota unknown protein
    • HSAF001435
    • SNX 15
    • SNX15
    • SNX15_HUMAN
    • Sorting nexin 15
    • Sorting nexin-15
    see all
  • Function

    May be involved in several stages of intracellular trafficking. Overexpression of SNX15 disrupts the normal trafficking of proteins from the plasma membrane to recycling endosomes or the TGN.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 MIT domain.
    Contains 1 PX (phox homology) domain.
  • Domain

    The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3-phosphate.
  • Cellular localization

    Cytoplasm. Membrane. Cytoplasmic vesicle membrane.
  • Information by UniProt

Images

  • ab162255 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up