Description

  • Product name

    Recombinant Human SNX17 protein
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKVLVNVL TSDQTEDVLE AVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEF ELPYVSVTSLRSQEYKIVLRKS YWDSAYDDDVMENRVGLNLLYAQTVS DIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQ TLRHYGYLRFDACV ADFPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVT SS VPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICL QSMVDELM VKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLESPDA TRESMVKLSSKLSAVSLRGI GSPSTDASASDVHGNFAFEGIGDEDL
    • Amino acids

      85 to 470

Specifications

Our Abpromise guarantee covers the use of ab93997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C.

    pH: 4.50
    Constituents: 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 130 µl aqua dest.

General Info

  • Alternative names

    • Similar to a putative C elegans gene encoded in cosmid F17H10
    • Snx17
    • SNX17_HUMAN
    • Sorting nexin 17
    • Sorting nexin-17
    see all
  • Function

    Critical regulator of endosomal recycling of numerous receptors, channels, and other transmembrane proteins. Binds to NPxY sequences in the cytoplasmic tails of target cargos. Plays a role in the sorting of endocytosed LRP1 and APP, and prevents their degradation. Required for maintenance of normal cell surface levels of APP and LRP1. Recycles internalized integrins ITGB1, ITGB5 and their associated alpha subunits, preventing them from lysosomal degradation. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)).
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
    Contains 1 Ras-associating domain.
  • Domain

    The PX domain mediates specific binding to phosphatidylinositol 3-phosphate (PtdIns(P3)). Required for association with endosomes.
    The PTB-like F3 module within the FERM-like domain mediates cargo recognition via their NPxY sequences, while the F1 module (Ras-associating) is responsible for interaction with membrane-bound HRAS.
  • Cellular localization

    Cytoplasm. Early endosome. Cytoplasmic vesicle membrane.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab93997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab93997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up