Overview

  • Product name
    Recombinant Human SNX2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAE DISANSNGPKPTEVVLDDDREDLFAEATEEVSLDSPEREPILSSEPSPAV TPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDPE KVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLH VGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHP TLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN ESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAM LGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLI AAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVANKPDKIQQAKNEI REWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQT QQQLIKYWEAFLPEAKAIA
    • Amino acids
      1 to 519
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC5204
    • SNX 2
    • SNX2
    • SNX2_HUMAN
    • Sorting nexin 2
    • Sorting nexin-2
    • Transformation related gene 9 protein
    • Transformation-related gene 9 protein
    • TRG 9
    • TRG-9
    • TRG9
    see all
  • Function
    May be involved in several stages of intracellular trafficking. Component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)) or phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).
  • Sequence similarities
    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
  • Cellular localization
    Early endosome membrane.
  • Information by UniProt

Images

  • ab159556 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up