Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLS SNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVMGKSRP GEMTYPGSRGETGTAPEPDPRCPRQSDML
    • Amino acids
      1 to 129
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Selectin ligand interactor cytoplasmic 1
    • Selectin ligand-interactor cytoplasmic 1
    • SLIC1
    • Snx20
    • SNX20_HUMAN
    • sorting nexin 20
    • Sorting nexin-20
    see all
  • Function
    Serves as a sorting protein that cycles P-selectin glycoprotein ligand 1 (PSLG1) into endosomes with no impact on leukocytes recruitment.
  • Sequence similarities
    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
  • Domain
    The PX domain binds phosphatidylinositol 3-phosphate which is necessary for localization to the endosomes.
  • Cellular localization
    Cell membrane. Cytoplasm. Nucleus. Endosome. Endosome membrane.
  • Information by UniProt

Images

  • ab165213 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up