Overview

  • Product name

    Recombinant Human SNX5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFMAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDI PDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDY AGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAV FKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGG FFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTR SHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSS DEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKD VKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIK HARNNVSLLQSCIDLFKNN
    • Molecular weight

      48 kDa including tags
    • Amino acids

      1 to 404
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      NP_055241.

Specifications

Our Abpromise guarantee covers the use of ab182806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab182806 is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.32% Tris HCl

    Buffer also contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • 0910001N05Rik
    • 1810032P22Rik
    • AU019504
    • D2Ertd52e
    • FLJ10931
    • OTTHUMP00000030340
    • OTTHUMP00000062927
    • OTTMUSP00000003367
    • OTTMUSP00000003368
    • RP11-504H3.2
    • RP23-35E16.2
    • snoRNA MBI-43
    • SNX 5
    • SNX5
    • SNX5_HUMAN
    • Sorting nexin 5
    • Sorting nexin-5
    see all
  • Function

    May be involved in several stages of intracellular trafficking. Plays a role in macropinocytosis. Plays a role in the internalization of EGFR after EGF stimulation.
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 BAR domain.
    Contains 1 PX (phox homology) domain.
  • Domain

    The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3,4-bisphosphate and/or phosphatidylinositol 4,5-bisphosphate.
  • Cellular localization

    Early endosome membrane. Cell membrane. Cytoplasmic vesicle membrane. Cytoplasm. Cell projection > phagocytic cup. Cell projection > ruffle. Recruited to the plasma membrane after EGF stimulation, which leads to increased levels of phosphatidylinositol 3,4-bisphosphate (PdtIns(3,4)P2). Detected on macropinosomes. Targeted to membrane ruffles in response to EGFR stimulation.
  • Information by UniProt

References

ab182806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up