Recombinant Human SOCS1 protein (His tag) (ab226430)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
Description
-
Product name
Recombinant Human SOCS1 protein (His tag)
See all SOCS1 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAP GDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGT FLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFEL LEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVL RDYLSSFPFQI -
Predicted molecular weight
28 kDa including tags -
Amino acids
1 to 211 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab226430 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
SDS-PAGE
-
Mass spectrometry
LC-MS/MS -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
General Info
-
Alternative names
- CIS1
- CISH 1
- CISH1
see all -
Function
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival (By similarity). Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2. -
Tissue specificity
Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Contains 1 SH2 domain.
Contains 1 SOCS box domain. -
Domain
The ESS and SH2 domains are required for JAK phosphotyrosine binding. Further interaction with the KIR domain is necessary for signal and kinase inhibition.
The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes. The Elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV] and is part of the SOCS box. - Information by UniProt
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226430 with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226430 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SOCS1.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226430 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SOCS1.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab226430 has not yet been referenced specifically in any publications.