Overview

  • Product name

    Recombinant Human SOCS2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYW GSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQ DGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHL YLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
    • Molecular weight

      49 kDa including tags
    • Amino acids

      1 to 198

Specifications

Our Abpromise guarantee covers the use of ab131812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CIS 2
    • CIS-2
    • CIS2
    • Cish 2
    • Cish2
    • Cytokine inducible SH2 protein 2
    • Cytokine-inducible SH2 protein 2
    • SOCS 2
    • SOCS-2
    • Socs2
    • SOCS2_HUMAN
    • SSI 2
    • SSI-2
    • SSI2
    • STAT induced STAT inhibitor 2
    • STAT-induced STAT inhibitor 2
    • STATI 2
    • STATI2
    • Suppressor of cytokine signaling 2
    see all
  • Function

    SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity

    High expression in heart, placenta, lung, kidney and prostate.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Domain

    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131812 stained with Coomassie Blue.

References

ab131812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up