For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-sod2mnsod-protein-ab93946.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Mitochondrial
Share by email

Recombinant human SOD2/MnSOD protein (ab93946)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human SOD2/MnSOD protein (ab93946)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 95% SDS-PAGE
    • Active: Yes
    • Suitable for: SDS-PAGE, MS

    You may also be interested in

    ELISA
    Product image
    Human SOD2 ELISA Kit (ab178012)

    View more associated products

    Description

    • Product name

      Recombinant human SOD2/MnSOD protein
      See all SOD2/MnSOD proteins and peptides
    • Biological activity

      Specific activity is > 1,200 units/mg, in which one unit will inhibit the rate of reduction of cytochrome c by 50% in a coupled system, using xanthine and Xanthine oxidase at pH 7.8 at 25°C in a 1.5 ml reaction volume.

      Activity Assay

      1. Prepare a 1.5 ml reaction mix into a suitable container and pre-chill on ice before use: The final concentrations are 50mM potassium phosphate, 0.1mM ethylendiaminetetraacetic acid, 0.01mM cytochrome C, 0.05mM xanthine, 0.005 units xanthine oxidase.
      2. Equilibrate to 25°C and monitor at A550nm until the value is constant using a spectrophotometer.
      3. Add 50 ul of recombinant SOD protein in various concentrations (0.5 ug, 1 ug) in assay buffer.
      4. Mix by inversion and record the increase at A550nm for 5 minutes.
    • Purity

      > 95 % SDS-PAGE.
      ab93946 was purified using conventional chromatography techniques.
    • Expression system

      Escherichia coli
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMKHSLPDLPYDYGALEPHINAQIMQLHHSK HHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT NLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFN KERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA IWNVINWENVTERYMACKK

    Associated products

    • Related Products

      • Anti-SOD2/MnSOD antibody (ab118340)
      • Anti-SOD2/MnSOD antibody (ab13533)
      • Anti-SOD2/MnSOD antibody (ab13534)
      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-SOD2/MnSOD antibody [mAbcam 74231] (ab74231)

    Specifications

    Our Abpromise guarantee covers the use of ab93946 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Mass Spectrometry

    • Mass spectrometry

      MALDI-TOF
    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine)

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    General Info

    • Alternative names

      • Indophenoloxidase B
      • IPO B
      • IPOB
      • Manganese containing superoxide dismutase
      • Manganese SOD
      • Manganese superoxide dismutase
      • Mangano superoxide dismutase
      • Mn SOD
      • Mn superoxide dismutase
      • MNSOD
      • MVCD6
      • SOD 2
      • SOD2
      • SODM_HUMAN
      • Superoxide dismutase [Mn] mitochondrial
      • Superoxide dismutase [Mn], mitochondrial
      • Superoxide dismutase 2 mitochondrial
      see all
    • Function

      Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
    • Involvement in disease

      Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6) [MIM:612634]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
    • Sequence similarities

      Belongs to the iron/manganese superoxide dismutase family.
    • Post-translational
      modifications

      Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.
    • Cellular localization

      Mitochondrion matrix.
    • Target information above from: UniProt accession P04179 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant human SOD2/MnSOD protein (ab93946)
      SDS-PAGE - Recombinant human SOD2/MnSOD protein (ab93946)
      15% SDS-PAGE analysis of ab93946 (3µg)

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab93946? Please let us know so that we can cite the reference in this datasheet.

    ab93946 has been referenced in 1 publication.

    • Zhang L  et al. Differential protein acetylation assists import of excess SOD2 into mitochondria and mediates SOD2 aggregation associated with cardiac hypertrophy in the murine SOD2-tg heart. Free Radic Biol Med 108:595-609 (2017). PubMed: 28433661

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab93946.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.