Recombinant human SOD2/MnSOD protein (ab93946)
- Datasheet
- References (1)
- Protocols
Description
-
Product name
Recombinant human SOD2/MnSOD protein
See all SOD2/MnSOD proteins and peptides -
Biological activity
Specific activity is > 1,200 units/mg, in which one unit will inhibit the rate of reduction of cytochrome c by 50% in a coupled system, using xanthine and Xanthine oxidase at pH 7.8 at 25°C in a 1.5 ml reaction volume.Activity Assay
- Prepare a 1.5 ml reaction mix into a suitable container and pre-chill on ice before use: The final concentrations are 50mM potassium phosphate, 0.1mM ethylendiaminetetraacetic acid, 0.01mM cytochrome C, 0.05mM xanthine, 0.005 units xanthine oxidase.
- Equilibrate to 25°C and monitor at A550nm until the value is constant using a spectrophotometer.
- Add 50 ul of recombinant SOD protein in various concentrations (0.5 ug, 1 ug) in assay buffer.
- Mix by inversion and record the increase at A550nm for 5 minutes.
-
Purity
> 95 % SDS-PAGE.
ab93946 was purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMKHSLPDLPYDYGALEPHINAQIMQLHHSK HHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT NLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFN KERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA IWNVINWENVTERYMACKK
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab93946 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.316% Tris HCl, 20% GlycerolThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Indophenoloxidase B
- IPO B
- IPOB
see all -
Function
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. -
Involvement in disease
Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6) [MIM:612634]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. -
Sequence similarities
Belongs to the iron/manganese superoxide dismutase family. -
Post-translational
modificationsNitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity. -
Cellular localization
Mitochondrion matrix. - Information by UniProt
Images
-
SDS-PAGE - Recombinant human SOD2/MnSOD protein (ab93946)15% SDS-PAGE analysis of ab93946 (3µg)
Datasheets and documents
References
This product has been referenced in:
- Zhang L et al. Differential protein acetylation assists import of excess SOD2 into mitochondria and mediates SOD2 aggregation associated with cardiac hypertrophy in the murine SOD2-tg heart. Free Radic Biol Med 108:595-609 (2017). Read more (PubMed: 28433661) »
