Description

  • Product name

    Recombinant Human SODD protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISW RVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQEQPPYPSYNS NYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTYPPGPGANTAS YSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPL RGQVPGYPPSQNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYG MGGRYPWPSSAPSAPPGNLYMTESTSPWPSSGSPQSPPSPPVQQPKDSSY PYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGN ATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEF VGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKIQAILE KLEKKGL
    • Predicted molecular weight

      76 kDa including tags
    • Amino acids

      1 to 457

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Silencer of Death Domain

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BAG 4
    • BAG family molecular chaperone regulator 4
    • BAG-4
    • BAG4
    • BAG4_HUMAN
    • Bcl 2 associated athanogene 4
    • Bcl-2-associated athanogene 4
    • BCL2 associated athanogene 4
    • Silencer of death domains
    • SODD
    see all
  • Function

    Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release (By similarity). Prevents constitutive TNFRSF1A signaling.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 BAG domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131858 stained with Coomassie Blue.

References

ab131858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up