Overview

  • Product name
    Recombinant Human Sohlh2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITI SDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFV FIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENAT GPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNK KISLLHSSKEKLRRLYRKHSSFCFW
    • Amino acids
      1 to 225
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHe81
    • FLJ20449
    • FLJ57222
    • SOHLH2
    • Solh2
    • SOLH2_HUMAN
    • SPATA28
    • Spermatogenesis and oogenesis specific basic helix loop helix 2
    • Spermatogenesis associated 28
    • Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2
    • TEB1
    see all
  • Function
    Probable transcription factor, which may be involved in spermatogenesis and oogenesis.
  • Sequence similarities
    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162901 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162901 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162901.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up