Overview

  • Product name
    Recombinant Human Solo protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEASVILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMDELSVTLDFL LSIPSEKCKARGFTVIVDGRKSQWNVVKTVVVMLQNVVPAEVSLVCVVKP DEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSLT YDHMDWLNKRLVFEKFTKESTSLLDELALINNGSDKGNQQEKERSVDLNF LPSVDPETVLQTGHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKL LDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQW GIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLV ELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGM LCVDVAPADGASIQQTLKLLEEKLKSVDVGLQGLREKGQGLLDQISNQAS WAYGKDVTIENKENVDHIQGVMEDMQLRKQRCEDMVDVRRLKMLQMVQLF KCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQS TYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHR LEMAIAFHSNAEKILQDCPEEPEAINDEEQFDEIEAVGKSLLDRLTVPVV YPDGTEQYFGSPSDMASTAENIRDRMKLVNLKRQQLRHPEMVTTES
    • Amino acids
      1 to 696
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • huntingtin interacting protein like protein
    • Huntingtin-interacting protein-like protein
    • Protein Solo
    • SEC14 and spectrin domains 1
    • SEC14 domain and spectrin repeat-containing protein 1
    • SESD1_HUMAN
    • sestd1
    • SOLO
    see all
  • Function
    May act as the primary docking protein directing membrane turnover and assembly of the transient receptor potential channels TRPC4 and TRPC5. Binds phospholipids such as phosphatidylinositol monophosphates, phosphatidylinositol diphosphates (PIP2s) and phosphatidic acid, but not less polar lipids including phosphatidylcholine, phosphatidylserine, and phosphatidylinositol. The binding to PIP2s is calcium dependent. Might be involved in the plasma membrane localization of CTNNB1.
  • Tissue specificity
    Broad expression. High expression in thalamus and brain. Significantly expressed in vasculature.
  • Sequence similarities
    Belongs to the SOLO family.
    Contains 1 CRAL-TRIO domain.
    Contains 3 spectrin repeats.
  • Information by UniProt

Images

  • ab164851 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up