Recombinant Human soluble IL2 Receptor gamma protein (ab191927)

Description

  • Product name

    Recombinant Human soluble IL2 Receptor gamma protein
    See all soluble IL2 Receptor gamma proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEI HLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLEL NWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFR VRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVDHHHHHH
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      23 to 262
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (extracellular domain).

Specifications

Our Abpromise guarantee covers the use of ab191927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 1.19% HEPES, 0.87% Sodium chloride, 0.03% DTT

    0.2 µM filtered solution

General Info

  • Alternative names

    • CD132
    • Cytokine receptor common gamma chain
    • Gamma-C
    • gammaC
    • IL-2 receptor subunit gamma
    • IL-2RG
    • IL2R gamma chain
    • IL2RG
    • IMD4
    • Interleukin-2 receptor subunit gamma
    • L-2R subunit gamma
    • p64
    see all
  • Relevance

    A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains.
  • Cellular localization

    Membrane; single-pass type I membrane protein

References

ab191927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up