Overview

  • Product name
    Recombinant Human Solute carrier family 22 member 18 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQGARAPRDQGQSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYL SRKLGLDSIAFGYLQTTFGVLQLLGGPVFGRFADQRGARAALTLSFLAAL ALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERP AALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFT CIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVAS NCPTGLFMVMFSIISMDFFQLEAAQAGYLMSFFGLLQMVTQGLVIGQLSS HFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQ VAINTLVLLVLWRKPMPQRKDKVR
    • Amino acids
      1 to 424
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beckwith Wiedemann syndrome chromosomal region 1 candidate gene A protein
    • Beckwith Wiedemann syndrome chromosome region 1 candidate A
    • BWR1A
    • BWSCR1A
    • DKFZp667A184
    • Efflux transporter like protein
    • HET
    • Imprinted multi membrane spanning polyspecific transporter related protein 1
    • IMPT1
    • ITM
    • MGC94186
    • ORCTL 2
    • ORCTL2
    • Organic cation transporter like protein 2
    • OTTMUSP00000030799
    • OTTMUSP00000030800
    • p45 Beckwith Wiedemann region 1 A
    • p45 BWR1A
    • SLC22A18
    • SLC22A1L
    • Solute carrier family 22 member 1 like
    • TSSC5
    • TSSC5v
    • Tumor suppressing STF cDNA 5 protein
    • Tumor suppressing subchromosomal transferable fragment candidate gene 5 protein
    see all
  • Relevance
    Solute carrier family 22 member 18 may act as a transporter of organic cations based on a proton efflux antiport mechanism. It may also play a role in the transport of chloroquine and quinidine-related compounds in kidney.
  • Cellular localization
    Apical cell membrane; Multi-pass membrane protein (Potential). Note: Localized at the apical membrane surface of renal proximal tubules.

Images

  • ab159035 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up