Description

  • Product name

    Recombinant Human Somatostatin Receptor 3/SSTR3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLV YLVVCVVGLLGNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFL AAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTR SARWRTAPVARTVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAA AWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRVWAPSCQRRRR SERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEE EDEEEEDGEESREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLL PQEASTGEKSSTMRISYL
    • Amino acids

      1 to 418
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Somatostatin Receptor 3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • OTTHUMP00000028737
    • Smstr 3
    • Smstr3
    • Somatostatin receptor subtype 3
    • Somatostatin receptor type 3
    • SS 3R
    • SS-3-R
    • SS3-R
    • SS3R
    • SSR 28
    • SSR-28
    • SSR28
    • SSR3_HUMAN
    • Sst 3
    • Sst3
    • SSTR 3
    • SSTR3
    see all
  • Function

    Receptor for somatostatins-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase.
  • Tissue specificity

    Brain, pituitary and pancreas.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation increases upon somatostatin binding.
  • Cellular localization

    Cell membrane. Internalized into endoplasmic vesicles upon somatostatin-stimulation.
  • Information by UniProt

Images

  • ab152709 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up