Description

  • Product name

    Recombinant Human SORCS3 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KRKIPWINIYAQVQHDKEQEMIGSVSQSENAPKITLSDFTEPEELLDKEL DTRVIGGIATIANSESTKEIPNCTSV
    • Amino acids

      1147 to 1222
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6330404A12Rik
    • KIAA1059
    • RP11 107L7.1
    • SORC3_HUMAN
    • SORCS
    • SORCS 3
    • SORCS3
    • Sortilin related VPS10 domain containing receptor 3
    • VPS10 domain containing receptor SorCS3
    • VPS10 domain receptor protein SORCS 3
    • VPS10 domain-containing receptor SorCS3
    see all
  • Tissue specificity

    Highly expressed in brain.
  • Sequence similarities

    Belongs to the VPS10-related sortilin family. SORCS subfamily.
    Contains 6 BNR repeats.
    Contains 1 PKD domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab161490 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up