Description

  • Product name

    Recombinant Human SOS1 protein (His tag)
  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPIIKAGTVIKLI ERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDAYL LQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPT VEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWT KEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQ VFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSED HYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLF NKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTHHHHHH
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      562 to 1052
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_005624

Specifications

Our Abpromise guarantee covers the use of ab233594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.02% Magnesium chloride

General Info

  • Alternative names

    • alternate SOS1
    • GF1
    • GGF1
    • GINGF
    • gingival fibromatosis
    • gingival fibromatosis hereditary 1
    • Guanine nucleotide exchange factor
    • HGF
    • NS4
    • Son of sevenless homolog 1
    • Son of sevenless homolog 1 (Drosophila)
    • SOS Ras/Rac guanine nucleotide exchange factor 1
    • SOS-1
    • Sos1
    • SOS1_HUMAN
    see all
  • Function

    Promotes the exchange of Ras-bound GDP by GTP.
  • Tissue specificity

    Expressed in gingival tissues.
  • Involvement in disease

    Defects in SOS1 are the cause of gingival fibromatosis 1 (GGF1) [MIM:135300]; also known as GINGF1. Gingival fibromatosis is a rare overgrowth condition characterized by a benign, slowly progressive, nonhemorrhagic, fibrous enlargement of maxillary and mandibular keratinized gingiva. GGF1 is usually transmitted as an autosomal dominant trait, although sporadic cases are common.
    Defects in SOS1 are the cause of Noonan syndrome type 4 (NS4) [MIM:610733]. NS4 is an autosomal dominant disorder characterized by dysmorphic facial features, short stature, hypertelorism, cardiac anomalies, deafness, motor delay, and a bleeding diathesis. It is a genetically heterogeneous and relatively common syndrome, with an estimated incidence of 1 in 1000-2500 live births. Rarely, NS4 is associated with juvenile myelomonocytic leukemia (JMML). SOS1 mutations engender a high prevalence of pulmonary valve disease; atrial septal defects are less common.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 PH domain.
    Contains 1 Ras-GEF domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab233594.

    MW: 50-70 kDa (SDS-PAGE under reducing conditions).

References

ab233594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up