Description

  • Product name

    Recombinant Human SOX6 protein
    See all SOX6 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNK PHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPH KPDEGSRDR
    • Amino acids

      1 to 109
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSSOX 6
    • HSSOX6
    • SOX 6
    • sox6
    • SOX6_HUMAN
    • SOXD
    • SRY (sex determining region Y) box 6
    • SRY box 6
    • SRY box containing gene 6
    • Transcription factor SOX 6
    • Transcription factor Sox-6
    • Transcription factor SOX6
    see all
  • Function

    Transcriptional activator. Binds specifically to the DNA sequence 5'-AACAAT-3'. Plays a key role in several developmental processes, including neurogenesis and skeleton formation.
  • Tissue specificity

    Expressed in a wide variety of tissues, most abundantly in skeletal muscle.
  • Sequence similarities

    Contains 1 HMG box DNA-binding domain.
  • Post-translational
    modifications

    Sumoylation inhibits the transcriptional activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153402 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up