Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAQQGQQGQMASGDSNLNFRMVAEIQNVEGQNLQEQVCPEPIFRFFRENK VEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNLVPVTRVMYCVLS ELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNENLSSSAVLCQLVSP NKDWRSHEESLAHTGTLRRSCM
    • Amino acids

      1 to 172
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • LY10_HUMAN
    • Lymphoid restricted homolog of Sp100
    • Lymphoid specific SP100 homolog
    • Lymphoid-restricted homolog of Sp100
    • LYSp100
    • LYSP100 A
    • LYSP100 B
    • LYSp100 protein
    • LYSP100-A
    • LYSP100-B
    • LYSP100A
    • LYSP100B
    • MGC126440
    • Nuclear antigen Sp140
    • Nuclear autoantigen Sp-140
    • Nuclear autoantigen Sp140
    • Nuclear body protein SP140
    • SP140
    • SP140 nuclear body protein
    • SP140 PEN
    • Speckled 140 kDa
    see all
  • Function

    Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection.
  • Tissue specificity

    High levels in spleen and peripheral blood leukocytes, much lower levels in thymus, prostate, ovary, small intestine, and colon. Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas.
  • Sequence similarities

    Contains 1 bromo domain.
    Contains 1 HSR domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 SAND domain.
  • Cellular localization

    Nucleus. Cytoplasm. Localized to nuclear structures termed LANDS, for LYSp100-associated nuclear domains. LANDS are globular, electron-dense structures most often found in the nucleoplasm, but also found at the nuclear membrane and in the cytoplasm, suggesting that these structures may traffic between the cytoplasm and the nucleus.
  • Information by UniProt

Images

  • ab153175 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up