Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQE PTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQL P
    • Amino acids
      321 to 421
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BS 84
    • CILD28
    • HSD 1
    • HSD-1
    • HSD1
    • hSMP1
    • MGC26201
    • MH SPAG8
    • OTTHUMP00000021352
    • OTTMUSP00000032209
    • SMP-1
    • SMP1
    • SPAG3
    • SPAG8
    • SPAG8_HUMAN
    • Sperm associated antigen 8
    • Sperm associated antigen 8 like protein
    • Sperm membrane protein 1
    • Sperm membrane protein BS-84
    • Sperm-associated antigen 8
    • Testicular tissue protein Li 177
    see all
  • Function
    May play a role in fertility and microtubule formation through interaction with RANBP9.
  • Tissue specificity
    Expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > acrosome. Acrosomal region of the head of mature sperm cells.
  • Information by UniProt

Images

  • ab161924 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up