Overview

  • Product name

    Recombinant Human SPAG8/SMP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      METNGSTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAA AAAAASAAAATAAFTTAKAAALSTKTPAPCSEFMEPSSDPSLLGEPCAGP GFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPGSSSGPVLGSS SGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPG PDTGPDSELSPCIPPGFRNLVADRVLNYTSWSQHCPWEPQKQPPWEFLQV LEPGARGLWKPPDIKGKLMVCYETLPRGQCLLYNWEEERATNHLDQVPSM QDGSESFFFRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKRE AMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTK PHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFTGVQEV LSALLRATPGEYSVNICGMNEHPVCSRTWTNRLCHQEMGSKKTVTQEDRG W
    • Amino acids

      1 to 501
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SPAG8. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BS 84
    • CILD28
    • HSD 1
    • HSD-1
    • HSD1
    • hSMP1
    • MGC26201
    • MH SPAG8
    • OTTHUMP00000021352
    • OTTMUSP00000032209
    • SMP-1
    • SMP1
    • SPAG3
    • SPAG8
    • SPAG8_HUMAN
    • Sperm associated antigen 8
    • Sperm associated antigen 8 like protein
    • Sperm membrane protein 1
    • Sperm membrane protein BS-84
    • Sperm-associated antigen 8
    • Testicular tissue protein Li 177
    see all
  • Function

    May play a role in fertility and microtubule formation through interaction with RANBP9.
  • Tissue specificity

    Expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > acrosome. Acrosomal region of the head of mature sperm cells.
  • Information by UniProt

Images

  • ab161923 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up