Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFL WAWNAPSEFCLGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDRLGYYP YIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNLGMAVIDWEEW RPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFL VETIKLGKLLRPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLS WLWNESTALYPSIYLNTQQSPVAATLYVRNRVREAIRVSKIPDAKSPLPV FAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHL NPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVK DTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLSATMFIVSILF LIISSVASL
    • Molecular weight

      84 kDa
    • Amino acids

      1 to 509

Specifications

Our Abpromise guarantee covers the use of ab132258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.

     This product was previously labelled as Hyaluronidase PH20

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • epididymis secretory sperm binding protein Li 96n
    • HEL-S-96n
    • HYA1
    • HYAL PH-20
    • HYAL PH20
    • Hyal-PH20
    • HYAL1
    • HYAL3
    • HYAL5
    • HYALP_HUMAN
    • Hyaluronidase PH-20
    • Hyaluronoglucosaminidase PH-20
    • MGC26532
    • PH-20 Hyaluronidase
    • PH20
    • PH20 Hyaluronidase
    • SPAG15
    • SPAM-1
    • Spam1
    • Sperm adhesion molecule 1
    • sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
    • Sperm surface protein PH-20
    • Sperm surface protein PH20
    • zona pellucida binding
    see all
  • Function

    Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
  • Tissue specificity

    Testis.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 56 family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132258 stained with Coomassie Blue.

References

This product has been referenced in:

  • Ma R  et al. PH20 Inhibits TGFß1-Induced Differentiation of Perimysial Orbital Fibroblasts via Hyaluronan-CD44 Pathway in Thyroid-Associated Ophthalmopathy. Invest Ophthalmol Vis Sci 60:1431-1441 (2019). Read more (PubMed: 30947333) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

Thank you for contacting us. Because we carry over 90,000 products, it isn't feasible for us to keep small sample sizes of our products.

We are happy to reassure our customers that all of our products are covered by our Abpromise, which guarantees that the product will work in the applications and species specified on the datasheet, or we will offer a replacement, credit, or refund within 6 months of purchase.

I hope this information is helpful. Please do not hesitate to contact us again with any other questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up