For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-spam1-protein-tagged-ab114725.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Basal Lamina
Share by email

Recombinant Human SPAM1 protein (Tagged) (ab114725)

  • Datasheet
  • SDS
Submit a review Q&A (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human SPAM1 protein (ab114725)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: ELISA, SDS-PAGE, WB

    Description

    • Product name

      Recombinant Human SPAM1 protein (Tagged)
      See all SPAM1 proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      P38567
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSS DYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKE
      • Predicted molecular weight

        37 kDa including tags
      • Amino acids

        346 to 445
      • Tags

        GST tag N-Terminus

    Associated products

    • Related Products

      • Anti-GST antibody [EPR4236] (ab111947)
      • Anti-GST antibody (ab19256)
      • Anti-SPAM1 antibody [1A4] (ab50694)
      • Anti-GST antibody (ab9085)

    Specifications

    Our Abpromise guarantee covers the use of ab114725 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      ELISA

      SDS-PAGE

      Western blot

    • Form

      Liquid
    • Additional notes

      This product was previously labelled as Hyaluronidase PH20.

      Protein concentration is above or equal to 0.05 ug/ul.

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.3% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • epididymis secretory sperm binding protein Li 96n
      • HEL-S-96n
      • HYA1
      • HYAL PH-20
      • HYAL PH20
      • Hyal-PH20
      • HYAL1
      • HYAL3
      • HYAL5
      • HYALP_HUMAN
      • Hyaluronidase PH-20
      • Hyaluronoglucosaminidase PH-20
      • MGC26532
      • PH-20 Hyaluronidase
      • PH20
      • PH20 Hyaluronidase
      • SPAG15
      • SPAM-1
      • Spam1
      • Sperm adhesion molecule 1
      • sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
      • Sperm surface protein PH-20
      • Sperm surface protein PH20
      • zona pellucida binding
      see all
    • Function

      Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
    • Tissue specificity

      Testis.
    • Sequence similarities

      Belongs to the glycosyl hydrolase 56 family.
    • Post-translational
      modifications

      N-glycosylated.
    • Cellular localization

      Cell membrane.
    • Target information above from: UniProt accession P38567 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human SPAM1 protein (ab114725)
      SDS-PAGE - Recombinant Human SPAM1 protein (ab114725)

      12.5% SDS-PAGE analysis of ab114725 stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab114725? Please let us know so that we can cite the reference in this datasheet.

    ab114725 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Question

    Product code: 112304
    Inquiry: I will like to know if is possible that you send me hyaluronidase PH-20 to use in a research project in my group

    Read More

    Abcam community

    Verified customer

    Asked on Feb 04 2013

    Answer

    Thank you for contacting us. Because we carry over 90,000 products, it isn't feasible for us to keep small sample sizes of our products.

    We are happy to reassure our customers that all of our products are covered by our Abpromise, which guarantees that the product will work in the applications and species specified on the datasheet, or we will offer a replacement, credit, or refund within 6 months of purchase.

    I hope this information is helpful. Please do not hesitate to contact us again with any other questions.

    Read More

    Abcam Scientific Support

    Answered on Feb 04 2013

    Question

    concentration de ab114725 lot 1384718 GR98907-1 ?
    0.05 mg/ml comme indiqué sur la fiche technique ou 0.1 mg/ml comme indiqué sur le tube?

    Read More

    Abcam community

    Verified customer

    Asked on Sep 27 2012

    Answer

    Merci de nous avoir contactés.

    Le laboratoire vient de me confirmer que la concentration de la protéineHyaluronidase PH20, lot GR98907-1 est de 0.1 mg/ml.

    La concentration de cette protéine dépend du lot, la fiche technique va être mise à jour avec cette information dans les meilleurs délais.

    Nous sommes désolés pour la confusion et espérons que cette information vous sera utile. N'hésitez pas à nous contacter de nouveau si vous avez d'autres questions.

    Read More

    Abcam Scientific Support

    Answered on Sep 27 2012

    Question

    functional activity?

    Read More

    Abcam community

    Verified customer

    Asked on Sep 18 2012

    Answer

    Thank you for contacting us and sorry for the delay of our reply.

    I just received a reply from the source of the Hyaluronidase PH20 protein ab114725. They confirmed that this protein has not been tested for functional studies.
    All tested applications are specified on our datasheets, and these are updated as soon as any new information is brought to our attention.

    If you would like to test the protein in this untested application, please contact our Scientific Support team prior to the purchase by replying to this message as you may be eligible for our testing discount program.

    Otherwise, we like to encourage all of our customers to submit an Abreview via the online product datasheet. We always appreciate customer feedback, whether positive or negative, and we make all product information available to researchers. Plus, each Abreview earns Abpoints that can be used for discounts on future purchases or rewards such as Amazon.com gift certificates.

    To find out more about our Abreview system, please see the following link: https://www.abcam.com/abreviews

    I hope this information is helpful. Please do not hesitate to contact me for any further advice or information in this regard.

    Read More

    Abcam Scientific Support

    Answered on Sep 18 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.