Recombinant Human SPAM1 protein (Tagged) (ab114725)

Submit a review Q&A (3)
SDS-PAGE - Recombinant Human SPAM1 protein (ab114725)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: ELISA, SDS-PAGE, WB

    Description

    • Product name

      Recombinant Human SPAM1 protein (Tagged)
      See all SPAM1 proteins and peptides

    • Expression system

      Wheat germ

    • Accession

      P38567

    • Protein length

      Protein fragment

    • Animal free

      No

    • Nature

      Recombinant

      • Species

        Human

      • Sequence

        RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSS DYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKE

      • Predicted molecular weight

        37 kDa including tags

      • Amino acids

        346 to 445

      • Tags

        GST tag N-Terminus

    Specifications

    Our Abpromise guarantee covers the use of ab114725 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      ELISA

      SDS-PAGE

      Western blot

    • Form

      Liquid

    • Additional notes

      This product was previously labelled as Hyaluronidase PH20.

      Protein concentration is above or equal to 0.05 ug/ul.

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.3% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • epididymis secretory sperm binding protein Li 96n
      • HEL-S-96n
      • HYA1
      • HYAL PH-20
      • HYAL PH20
      • Hyal-PH20
      • HYAL1
      • HYAL3
      • HYAL5
      • HYALP_HUMAN
      • Hyaluronidase PH-20
      • Hyaluronoglucosaminidase PH-20
      • MGC26532
      • PH-20 Hyaluronidase
      • PH20
      • PH20 Hyaluronidase
      • SPAG15
      • SPAM-1
      • Spam1
      • Sperm adhesion molecule 1
      • sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
      • Sperm surface protein PH-20
      • Sperm surface protein PH20
      • zona pellucida binding
      see all

    • Function

      Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.

    • Tissue specificity

      Testis.

    • Sequence similarities

      Belongs to the glycosyl hydrolase 56 family.

    • Post-translational
      modifications

      N-glycosylated.

    • Cellular localization

      Cell membrane.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human SPAM1 protein (ab114725)
      SDS-PAGE - Recombinant Human SPAM1 protein (ab114725)

      12.5% SDS-PAGE analysis of ab114725 stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab114725? Please let us know so that we can cite the reference in this datasheet.

    ab114725 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Question

    Product code: 112304
    Inquiry: I will like to know if is possible that you send me hyaluronidase PH-20 to use in a research project in my group

    Read More
    Answer

    Thank you for contacting us. Because we carry over 90,000 products, it isn't feasible for us to keep small sample sizes of our products.

    We are happy to reassure our customers that all of our products are covered by our Abpromise, which guarantees that the product will work in the applications and species specified on the datasheet, or we will offer a replacement, credit, or refund within 6 months of purchase.

    I hope this information is helpful. Please do not hesitate to contact us again with any other questions.

    Read More

    Question

    concentration de ab114725 lot 1384718 GR98907-1 ?
    0.05 mg/ml comme indiqué sur la fiche technique ou 0.1 mg/ml comme indiqué sur le tube?

    Read More
    Answer

    Merci de nous avoir contactés.

    Le laboratoire vient de me confirmer que la concentration de la protéineHyaluronidase PH20, lot GR98907-1 est de 0.1 mg/ml.

    La concentration de cette protéine dépend du lot, la fiche technique va être mise à jour avec cette information dans les meilleurs délais.

    Nous sommes désolés pour la confusion et espérons que cette information vous sera utile. N'hésitez pas à nous contacter de nouveau si vous avez d'autres questions.

    Read More

    Question

    functional activity?

    Read More
    Answer

    Thank you for contacting us and sorry for the delay of our reply.

    I just received a reply from the source of the Hyaluronidase PH20 protein ab114725. They confirmed that this protein has not been tested for functional studies.
    All tested applications are specified on our datasheets, and these are updated as soon as any new information is brought to our attention.

    If you would like to test the protein in this untested application, please contact our Scientific Support team prior to the purchase by replying to this message as you may be eligible for our testing discount program.

    Otherwise, we like to encourage all of our customers to submit an Abreview via the online product datasheet. We always appreciate customer feedback, whether positive or negative, and we make all product information available to researchers. Plus, each Abreview earns Abpoints that can be used for discounts on future purchases or rewards such as Amazon.com gift certificates.

    To find out more about our Abreview system, please see the following link: https://www.abcam.com/abreviews

    I hope this information is helpful. Please do not hesitate to contact me for any further advice or information in this regard.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com