Recombinant Human SPATC1 protein (ab166382)

Overview

  • Product name
    Recombinant Human SPATC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALAPLAEMLTSLQPSATPGSLMSPLTGTLSTLLSGPAPTSQSSPLTSFL TSPIAGPLTGTLASSLGLPSTGTLTPSSLVAGPVAMSQSSPLIAPVMGTV AVSLSSPLLSSTATPPGVSQNLLANPMSNLVLPEAPRLRLAEPLRGGPTG PQSPACVVPTATTKVPLSTEPPQSTQDPEPLSMAFAGAPLQTSTPIGAMG TPAPKTAFSFNTSDTQAQPSAAQEQVVPASVPTSPTTSPTVTVLASAPAL APQVATSYTPSSTTHIAQGAPHPPSRMHNSPTQNLPVPHCPPHNAHSPPR TSSSPASVNDSRGPRTTEPSTKSMMEVERKLAHRKTSKFPENPRESKQLA WERLVGEIAFQLDRRILSSIFPERVRLYGFTASNIPEKIIQASLNPSDHK LDEKLCQRLTQRYVSVMNRLQSLGYNGRVHPALTEQLVNAYGILRERPEL AASEGGPYTVDFLQRVVVETVHPGMLADALLLLSCLSQLAHDDGKPMFIW
    • Amino acids
      1 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700084J23Rik
    • MGC144830
    • MGC61633
    • SPATA15
    • Spatc1
    • SPERI_HUMAN
    • Speriolin
    • Spermatogenesis and centriole associated 1
    • Spermatogenesis and centriole-associated protein 1
    • Spermatogenesis-associated protein 15
    • Spermatogenic cell specific Cdc20 binding protein
    • Spermatogenic cell-specific Cdc20-binding protein
    see all
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Colocalizes with the centrosomal pericentrin protein PCNT1.
  • Information by UniProt

Images

  • ab166382 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up