Overview

  • Product name

    Recombinant Human SPC24 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEK QLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKAS LLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIE WDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW
    • Amino acids

      1 to 197
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ90806
    • hSpc24
    • Kinetochore protein Spc24
    • SPBC24
    • spc24
    • SPC24 NDC80 kinetochore complex component
    • SPC24 NDC80 kinetochore complex component homolog
    • SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae)
    • SPC24_HUMAN
    • Spindle pole body component 24 homolog
    • Spindle pole body component 24 homolog (S. cerevisiae)
    see all
  • Function

    Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore.
  • Sequence similarities

    Belongs to the SPC24 family.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore.
  • Information by UniProt

Images

  • ab165567 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up