Overview

  • Product name

    Recombinant Human SPCS1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVY IVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRH AKNN
    • Amino acids

      1 to 104
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSPC033
    • Microsomal signal peptidase 12 kDa subunit
    • OTTHUMP00000206959
    • signal peptidase 12kDa
    • Signal peptidase complex subunit 1
    • signal peptidase complex subunit 1 homolog (S. cerevisiae)
    • SPase 12 kDa subunit
    • SPC1
    • SPC12
    • SPCS1
    • SPCS1_HUMAN
    • YJR010C-A
    see all
  • Function

    Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
  • Sequence similarities

    Belongs to the SPCS1 family.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162190 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up