Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDITADLENIFDWN VKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFD DGNGLKGNRN
    • Amino acids
      32 to 141
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp564J1864
    • FLJ22649
    • Microsomal signal peptidase 22/23 kDa subunit
    • Microsomal signal peptidase 23 kDa subunit
    • PRO3567
    • Signal peptidase complex subunit 3
    • Signal peptidase complex subunit 3 homolog
    • Signal peptidase complex subunit 3 homolog (S. cerevisiae)
    • SPase 22 kDa subunit
    • SPase 22/23 kDa subunit
    • SPC22
    • SPC22/23
    • SPC3
    • UNQ1841
    • YLR066W
    see all
  • Relevance
    A component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
  • Cellular localization
    Endoplasmic reticulum and Microsome membrane;: Single-pass type II membrane protein

Images

  • ab163732 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up