Overview

  • Product name

    Recombinant Human SPG11 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLRKILASQQPDRCKRAQAFISTQGLKPDTVAELVAEEVTRELLTSSQGT GHKQMFNPTEESQTFLQLTTLCQDRTLVGMKLLDKISSVPHGELSCTTEL LILAHHCFTLTCHMEGIIRVLQAAHMLTDNHLAPSEEYGLVVRLLTGIGR YNEMTYIFDLLHKKHYFEVLMRKKLDPSGTLKTALLDYIKRCRPGDSEKH NMIALCFSMCREIGENHEAAARIQLKLIESQPWEDSLKDGHQLKQLLLKA LTLMLDAAESYAKDSCVRQAQHCQRLTKLITLQIHFLNTGQNTMLINLGR HKLMDCILALPRFYQASIVAEAYDFVPDWAEILYQQVILKGDFNYLEEFK QQRLLKSSIFEEISKKYKQHQPTDMVMENLKKLLTYCEDVYLYYKLAYEH KFYEIVNVLLKDPQTGCCLKDMLAG
    • Amino acids

      1 to 425
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Colorectal carcinoma associated protein
    • Colorectal carcinoma-associated protein
    • DKFZp762B1512
    • FLJ21439
    • KIAA1840
    • Spastic paraplegia 11
    • Spastic paraplegia 11 (autosomal recessive)
    • Spastic paraplegia 11 protein
    • Spatacsin
    • SPG 11
    • Spg11
    • SPTCS_HUMAN
    see all
  • Tissue specificity

    Expressed in all structures of brain, with a high expression in cerebellum.
  • Involvement in disease

    Defects in SPG11 are the cause of spastic paraplegia autosomal recessive type 11 (SPG11) [MIM:604360]. Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Membrane. Cytoplasm > cytosol. Nucleus. Mainly cytoplasmic.
  • Information by UniProt

Images

  • ab153523 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up