Overview

  • Product name

    Recombinant Human SPG7/PGN protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAVLLLLLRALRRGPGPGPRPLWGPGPAWSPGFPARPGRGRPYMASRPPG DLAEAGGRALQSLQLRLLTPTFEGINGLLLKQHLVQNPVRLWQLLGGTFY FNTSRLKQKNKEKDKSKGKAPEEDEEERRRRERDDQMYRERLRTLLVIAV VMSLLNALSTSGGSISWNDFVHEMLAKGEVQRVQVVPESDVVEVYLHPGA VVFGRPRLALMYRMQVANIDKFEEKLRAAEDELNIEAKDRIPVSYKRTGF FGNALYSVGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDG KMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGP PGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARAR APCIVYIDEIDAVGKKRSTTMSGFSNTEEEQTLNQLLVEMDGMGTTDHVI VLASTNRADILDGALMRPGRLDRHVFIDLPTLQERREIFEQHLKSLKLTQ SSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNFEYAVE RVLAGTAKKSKILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRT NAALGFAQMLPRDQHLFTKEQLFERMCMALGGRASEALSFNEVTSGAQDD LRKVTRIAYSMVKQFGMAPGIGPISFPEAQEGLMGIGRRPFSQGLQQMMD HEARLLVAKAYRHTEKVLQDNLDKLQALANALLEKEVINYEDIEALIGPP PHGPKKMIAPQRWIDAQREKQDLGEEETEETQQPPLGGEEPTWPK
    • Molecular weight

      115 kDa including tags
    • Amino acids

      1 to 795

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as SPG7

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAR
    • Cell adhesion regulator
    • Cell matrix adhesion regulator
    • CMAR
    • Paraplegin
    • PGN
    • Spastic paraplegia 7 (pure and complicated autosomal recessive)
    • Spastic paraplegia 7 homolog (human)
    • Spastic paraplegia 7 protein
    • Spastic paraplegia 7, paraplegin (pure and complicated autosomal recessive)
    • Spastic paraplegia protein 7
    • SPG5C
    • Spg7
    • SPG7 gene
    • SPG7_HUMAN
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132738 stained with Coomassie Blue

References

ab132738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up