Description

  • Product name

    Recombinant Human Sphingomyelin Synthase 1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLC RVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSI KIKPNGMPNGYRKEMIKIPMPELERSQYPMEWGKTFLAFLYALSCFVLTT VMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGLWLI QWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGMHFNCSPKLFG DWEAQLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYLFIKEYS PRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTM ANQQVLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHL SRQVKYSRLVNDT
    • Amino acids

      1 to 413
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MOB
    • Phosphatidylcholine:ceramide cholinephosphotransferase 1
    • Protein Mob
    • SGMS1
    • SMS 1
    • SMS1
    • TMEM23
    • Transmembrane protein 23
    see all
  • Relevance

    Sphingomyelin synthase 1 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Sphingomyelin synthase 1 is required for cell growth and is also capable of suppressing BAX-mediated apoptosis and preventing cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. It may protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide.
  • Cellular localization

    Golgi Apparatus. Multi-pass membrane protein

Images

  • ab166087 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up