Overview

  • Product name

    Recombinant Human Sphingomyelin Synthase 2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLR KGTKKYPDYIQIAMPTESRNKFPLEWWKTGIAFIYAVFNLVLTTVMITVV HERVPPKELSPPLPDKFFDYIDRVKWAFSVSEINGIILVGLWITQWLFLR YKSIVGRRFCFIIGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQAKV QRILRLISGGGLSITGSHILCGDFLFSGHTVTLTLTYLFIKEYSPRHFWW YHLICWLLSAAGIICILVAHEHYTIDVIIAYYITTRLFWWYHSMANEKNL KVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKK YSRVQKIGEDNEKST
    • Amino acids

      1 to 365
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC26963
    • Phosphatidylcholine:ceramide cholinephosphotransferase 2
    • SGMS 2
    • Sgms2
    • SM synthase
    • SMS 2
    • SMS2
    • SMS2_HUMAN
    • Sphingomyelin synthase 2
    see all
  • Function

    Bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. Directly and specifically recognizes the choline head group on the substrate. Also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. Does not function strictly as a SM synthase. Required for cell growth.
  • Tissue specificity

    Brain, heart, kidney, liver, muscle and stomach.
  • Sequence similarities

    Belongs to the sphingomyelin synthase family.
  • Post-translational
    modifications

    Palmitoylated on Cys-331, Cys-332, Cys-343 and Cys-348; which plays an important role in plasma membrane localization.
  • Cellular localization

    Cell membrane. Golgi apparatus membrane. Predominantly plasma membrane, some in Golgi apparatus.
  • Information by UniProt

Images

  • ab153615 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up