Description

  • Product name

    Recombinant Human Sphingosine 1 phosphate phosphatase 2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEH LPAANGKGGEAPANGLRRAAAPEAYVQKYVVKNYFYYYLFQFSAALGQEV FYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLKWPRPSSPPVV KLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFS TLVCLSRLYTGMHTVLDVLGGVLITALLIVLTYPAWTFIDCLDSASPLFP VCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL YSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP
    • Amino acids

      1 to 399
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ39004
    • hSPP2
    • SGPP2
    • Sphingosine 1 Phosphatase 2
    • SPP2
    • SPPase 2
    see all
  • Relevance

    Sphingosine 1 phosphate phosphotase 2 is a highly bioactive lipid that has a myriad of biological effects both intracellularly as a second messenger and extracellularly by binding to the S1P(1-5)/G protein-coupled receptors of the endothelial differentiation gene family. Intracellularly, at least two enzymes, sphingosine kinase (1 and 2) and S1P phosphatase, regulate the activity of S1P by governing the phosphorylation of S1P. SPPase2 is localized to the endoplasmic reticulum. The enzymatic activity and localization of SPPase2 are similar to SPPase1. The tissue expression of SPPase2 was different from that of SPPase1. SPPase2 is an important member of the SPPase family which play a role in attenuating intracellular S1P signaling.
  • Cellular localization

    Endoplasmic reticulum

Images

  • ab165326 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up