Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPP AYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHH
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as NCKIPSD.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 54 kDa VacA-interacting protein
    • 54 kDa vimentin-interacting protein
    • 90 kDa SH3 protein interacting with Nck
    • AF3p21
    • dia interacting protein
    • Dia-interacting protein 1
    • Diaphanous protein-interacting protein
    • DIP
    • DIP-1
    • DIP1
    • NCK interacting protein with SH3 domain
    • NCK-interacting protein with SH3 domain
    • Nckipsd
    • ORF1
    • SH3 adapter protein SPIN90
    • SH3 protein interacting with Nck 90 kDa
    • SPIN90
    • SPN90_HUMAN
    • VIP54
    • WASLBP
    • WASP-interacting SH3-domain protein
    • WISH
    • wiskott- Aldrich syndrome protein-interacting protein
    • Wiskott-Aldrich syndrome protein-interacting protein
    see all
  • Function
    Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo (By similarity). In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 (By similarity). May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion.
  • Tissue specificity
    Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen.
  • Involvement in disease
    Note=A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with MLL.
  • Sequence similarities
    Contains 1 SH3 domain.
  • Cellular localization
    Nucleus. Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes.
  • Information by UniProt

Images

  • ab162582 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up