Overview

  • Product name

    Recombinant Human Spindly protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEADIITNLRCRLKEAEEERLKAAQYGLQLVESQNELQNQLDKCRNEMMT MTESYEQEKYTLQREVELKSRMLESLSCECEAIKQQQKMHLEKLEEQLSR SHGQEVNELKTKIEKLKVELDEARLSEKQLKHQVDHQKELLSCKSEELRV MSERVQESMSSEMLALQIELTEMESMKTTLKEEVNELQYRQEQLELLITN LMRQVDRLKEEKEEREKEAVSYYNALEKARVANQDLQVQLDQALQQALDP NSKGNSLFAEVEDRRAAMERQLISMKVKYQSLKKQNVFNREQMQRMKLQI ATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSM ESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELSIQRMKALFES QRALDIERKLFANERCLQLSESENMKLRAKLDELKLKYEPEETVEVPVLK KRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEETQSCPNSLEDNNLQ LEKSVSIHTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPADAEALSERSG NTPNSPRLAAESKLQTEVKEGKETSSKLEKETCKKSHPILYVSSKSTPET QCPQQ
    • Amino acids

      1 to 605
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AA409762
    • Arsenite related gene 1 protein
    • Arsenite-related gene 1 protein
    • CCDC 99
    • Ccdc99
    • Coiled coil domain containing 99
    • Coiled-coil domain-containing protein 99
    • FLJ20364
    • FLJ40690
    • hSpindly
    • MGC124977
    • Protein Spindly
    • rhabdomyosarcoma antigen MU RMS 40.4A
    • Rhabdomyosarcoma antigen MU-RMS-40.4A
    • Rrhabdomyosarcoma antigen protein MU RMS 40.4A
    • SPDL1
    • SPDLY_HUMAN
    • Spindle apparatus coiled coil domain containing protein 1
    • Spindle apparatus coiled coil protein 1
    • Spindly
    • Spindly homolog
    see all
  • Function

    Required for the localization of dynein and dynactin to the mitotic kintochore. Dynein is believed to control the initial lateral interaction between the kinetochore and spindle microtubules and to facilitate the subsequent formation of end-on kinetochore-microtubule attachments mediated by the NDC80 complex. Also required for correct spindle orientation. Does not appear to be required for the removal of spindle assembly checkpoint (SAC) proteins from the kinetochore upon bipolar spindle attachment.
  • Sequence similarities

    Belongs to the Spindly family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Chromosome > centromere > kinetochore. Nucleus. Cytoplasm > cytoskeleton > spindle pole. Localizes to the nucleus in interphase and to the kinetochore in early prometaphase. Relocalizes to the mitotic spindle pole before metaphase and is subsequently lost from the spindle poles after chromosome congression is completed. Removal of this protein from the kinetochore requires the dynein/dynactin complex.
  • Information by UniProt

Images

  • ab162888 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up