Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTD GNTYPNECVLCFENRKRQTSILIQKSGPC
    • Molecular weight

      35 kDa including tags
    • Amino acids

      1 to 79

Specifications

Our Abpromise guarantee covers the use of ab152702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as SPINK1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ISK1_HUMAN
    • Pancreatic secretory trypsin inhibitor
    • Pancreatic serine protease inhibitor Kazal
    • PCTT
    • PSTI
    • Serine protease inhibitor Kazal type 1
    • Serine protease inhibitor Kazal-type 1
    • Spink 3
    • SPINK1
    • Spink3
    • TaTI
    • TCP
    • Tumor associated trypsin inhibitor
    • Tumor-associated trypsin inhibitor
    see all
  • Function

    Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:7142173). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.
    In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.
  • Involvement in disease

    Pancreatitis, hereditary
    Tropical calcific pancreatitis
  • Sequence similarities

    Contains 1 Kazal-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152702 stained with Coomassie Blue.

References

ab152702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up