Overview

  • Product name

    Recombinant Human SPINK4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQ DIQIMKDGKCVDHHHHHH
    • Molecular weight

      8 kDa including tags
    • Amino acids

      27 to 86
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab152050 is 0.2 µM filtered.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.00
    Constituents: 0.39% MES, 0.05% Brij, 0.02% Calcium chloride, 0.02% DTT, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Gastrointestinal peptide
    • ISK4_HUMAN
    • PEC 60
    • PEC60
    • Peptide PEC-60 homolog
    • Serine peptidase inhibitor Kazal type 4
    • Serine protease inhibitor Kazal-type 4
    • SPINK4
    see all
  • Sequence similarities

    Contains 1 Kazal-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab152050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up