Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVD CKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTIS EI
    • Amino acids
      482 to 583
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SPIRE1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1135
    • MGC150621
    • MGC150622
    • Protein spire homolog 1
    • Spir 1
    • Spir-1
    • Spir1
    • SPIR1_HUMAN
    • SPIRE 1
    • Spire homolog 1
    • spire1
    see all
  • Function
    Acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Involved in vesicle transport processes providing a novel link between actin organization and intracellular transport.
  • Sequence similarities
    Belongs to the spire family.
    Contains 1 KIND domain.
    Contains 2 WH2 domains.
  • Domain
    Binds to actin monomers via the WH2 domain.
    The Spir-box targets binding to intracellular membrane structures.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasm > perinuclear region. Punctate spots in perinuclear region and cytoplasm, co-localised with Rab11.
  • Information by UniProt

Images

  • ab163423 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up