Description

  • Product name

    Recombinant Human sPLA2-X protein (His tag)
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQ ELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      43 to 165
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature chain without signal peptide, without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab63847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form

    Lyophilised
  • Additional notes

    Product is NOT sterile! Please filter the product by an appropriate sterile filter before using it in cell culture.

     This product was previously labelled as Phospholipase A2 X

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituent: 0.121% Tris

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names

    • Group 10 secretory phospholipase A2
    • Group X secretory phospholipase A2
    • GX sPLA2
    • GXPLA2
    • GXSPLA2
    • PA2GX_HUMAN
    • Phosphatidylcholine 2 acylhydrolase GX
    • Phosphatidylcholine 2-acylhydrolase 10
    • Phospholipase A2 group X
    • PLA2G10
    • SPLA2
    • sPLA2-X
    • sPLA2X
    see all
  • Function

    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine.
  • Tissue specificity

    Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon.
  • Sequence similarities

    Belongs to the phospholipase A2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12% SDS-PAGE separation of ab63847. Molecular Weight: ~15.5 kDa.

    Lane 1. Molecular weight marker
    Lane 2. reduced and heated sample, 5μg/lane
    Lane 3. non-reduced and non-heated sample, 5μg/lane

References

ab63847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab63847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up