Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQER AYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFR TRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEI NFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGED EPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARL NGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHP LPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQY LGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPPW QQQQQQPPPPPPPSSSMASSTPLPWQQRSLPAAAMARAMRVRTFRAHW
    • Amino acids
      1 to 548
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BBP
    • D11S636
    • Mammalian branch point binding protein mBBP
    • OTTHUMP00000069749
    • OTTHUMP00000069750
    • OTTHUMP00000069752
    • Splicing factor 1
    • Transcription factor ZFM1
    • ZFM1
    • Zinc finger gene in MEN1 locus
    • Zinc finger protein 162
    • ZNF162
    see all
  • Relevance
    SF1 contains 1 KH domain, 1 CCHC type zinc finger, a nuclear transport domain and glutamine and proline rich regions. It is necessary for the ATP dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5' UACUAAC 3' of the pre mRNA. It may act as transcription repressor. There are 6 named isoforms produced by alternative splicing.
  • Cellular localization
    Nuclear

Images

  • ab159822 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up