Overview

  • Product name

    Recombinant Human SPNXA protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTI LVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK
    • Amino acids

      1 to 97
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 11.1
    • Cancer/Testis Antigen Family 11, Member 1
    • CT11.1
    • NAP-X
    • Nuclear-associated protein SPAN-Xa
    • SPAN-X
    • SPANX family member A
    • SPANX Family, Member A1
    • SPANX-A
    • SPANXA1
    • SPANXA2
    • Sperm protein associated with the nucleus on the X chromosome A
    • Sperm Protein Associated With The Nucleus, X-Linked, Family Member A1
    • SPNXA_HUMAN
    see all
  • Tissue specificity

    Detected in testis and sperm.
  • Sequence similarities

    Belongs to the SPAN-X family.
  • Developmental stage

    Detected in round and elongating spermatids.
  • Cellular localization

    Cytoplasm. Nucleus. Associated with nuclear craters.
  • Information by UniProt

Images

  • ab162315 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up