Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      YGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLD SILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKL KFGGW
    • Amino acids

      291 to 395
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 35
    • CT35
    • Meiotic recombination protein SPO 11
    • Meiotic recombination protein SPO11
    • MGC39953
    • SPATA43
    • Spermatogenesis associated 43
    • SPO 11
    • SPO11
    • SPO11 meiotic protein covalently bound to DSB
    • SPO11 meiotic protein covalently bound to DSB homolog
    • SPO11 meiotic protein covalently bound to DSB like
    • SPO11_HUMAN
    • TOPVIA
    see all
  • Function

    Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination (By similarity). Essential for the phosphorylation of SMC3, HORMAD1 and HORMAD2.
  • Tissue specificity

    Highly expressed in testis.
  • Sequence similarities

    Belongs to the TOP6A family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab161724 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up