Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQ YDRDKYWNRFRDDDYFRNWNPNKPFDKALDPSKDPCLKVKCSPHKVCVTQ DYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGS DGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTD KELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGRFDTSILPICKDSLG WMFNKLDMNYDLLLDPSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNE WCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHG STGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEY ERELGPKDKEGKLRVHTRAVTEDDEDEDDDKEDEVGYIW
    • Amino acids
      1 to 439
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Sparc/osteonectin, cwcv and kazal like domains proteoglycan
    • Sparc/osteonectin, cwcv and kazal like domains proteoglycan 1
    • SPOCK
    • TESTICAN
    • Testican 1
    • TIC1
    • TICN1
    see all
  • Relevance
    SPOCK1 is the protein core of a seminal plasma proteoglycan containing chondroitin- and heparan-sulfate chains. The protein's function is unknown, although similarity to thyropin-type cysteine protease-inhibitors suggests its function may be related to protease inhibition.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.

Images

  • ab159571 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up