Overview

  • Product name
    Recombinant Human SPOCK2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYIKS WEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRIK QPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSSKQL AVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENS KQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAA INLDKYEVCIRPFFNSCDTYKDGRVSTAEWCFCFWREKPPCLAELERIQI QEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHG SPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDGGY IW
    • Amino acids
      23 to 424
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • and Kazal-like domains proteoglycan 2
    • CWCV
    • FLJ97039
    • KIAA0275
    • SPARC/osteonectin
    • Sparc/osteonectin cwcv and kazal like domains proteoglycan (testican) 2
    • Sparc/osteonectin cwcv and kazal like domains proteoglycan 2
    • SPOCK 2
    • Spock2
    • Testican 2
    • Testican-2
    • Testican2
    • TICN 2
    • TICN2
    • TICN2_HUMAN
    see all
  • Function
    May participate in diverse steps of neurogenesis. Binds calcium.
  • Tissue specificity
    Highly expressed in brain. Also found in lung and testis.
  • Sequence similarities
    Contains 1 Kazal-like domain.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications
    Contains chondroitin sulfate and heparan sulfate O-linked oligosaccharides.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab160659 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up