Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEG HCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT
    • Amino acids

      132 to 230
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSAJ1454
    • OTTHUMP00000219853
    • OTTHUMP00000219854
    • OTTHUMP00000219857
    • OTTHUMP00000219858
    • OTTHUMP00000219862
    • OTTHUMP00000219864
    • OTTHUMP00000219865
    • OTTHUMP00000219866
    • OTTHUMP00000219867
    • OTTHUMP00000219868
    • Sparc/osteonectin, cwcv and kazal like domains proteoglycan (testican) 3
    • SPARC/osteonectin, CWCV, and Kazal like domains proteoglycan 3
    • TES 3
    • testican 3
    • TICN3
    see all
  • Relevance

    SPOCK3 may participate in diverse steps of neurogenesis. It inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP and may also interfere with tumor invasion.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix.

Images

  • ab162373 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up