Description

  • Product name

    Recombinant Human SPOP protein
  • Purity

    > 90 % SDS-PAGE.
    ab105599 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSRVPSPPPPAEMSSGPVAESWCYTQIKVV KFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEES KDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKD WGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFE HEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHAS DVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 374
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.077% DTT, 0.316% Tris HCl, 0.0584% EDTA, 50% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • BTBD32
    • HIB homolog 1
    • Roadkill homolog 1
    • Speckle type POZ protein
    • Speckle-type POZ protein
    • SPOP
    • SPOP_HUMAN
    • TEF 2
    • TEF2
    see all
  • Function

    Inhibits IPF1/PDX1 transactivation of established target promoters, such as insulin, may be by recruiting a repressor complex (By similarity). In complex with CUL3, involved in ubiquitination of BMI1, H2AFY and DAXX, and probably also in ubiquitination and proteasomal degradation of Gli2 or Gli3.
  • Tissue specificity

    Widely expressed.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the Tdpoz family.
    Contains 1 BTB (POZ) domain.
    Contains 1 MATH domain.
  • Domain

    The MATH domain interacts with H2AFY and BMI1.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab105599.

References

ab105599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up