Description

  • Product name

    Recombinant Human SPP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFG ALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEY INLLLSMYFFVLGILALSHTIRSEGISLQHLKQLSREPVQGLG
    • Amino acids

      1 to 143
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Signal Peptide Peptidase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • dJ324O17.1
    • H13
    • hIMP1
    • Histocompatibility (minor) 13
    • HM13
    • HM13_HUMAN
    • IMP-1
    • IMP1
    • IMPAS
    • IMPAS-1
    • Intramembrane protease
    • Intramembrane protease 1
    • Minor histocompatibility antigen 13
    • Minor histocompatibility antigen H13
    • MSTP086
    • OTTHUMP00000030527
    • OTTHUMP00000030528
    • OTTHUMP00000030530
    • OTTHUMP00000214528
    • Presenilin-like protein 3
    • PSENL3
    • PSL3
    • Signal peptide peptidase
    • Signal peptide peptidase beta
    • SPP
    see all
  • Function

    Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. May play a role in graft rejection (By similarity). May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein. Involved in the intramembrane cleavage of the integral membrane protein PSEN1.
  • Tissue specificity

    Widely expressed with highest levels in kidney, liver, placenta, lung, leukocytes and small intestine and reduced expression in heart and skeletal muscle. Expressed abundantly in the CNS with highest levels in thalamus and medulla.
  • Sequence similarities

    Belongs to the peptidase A22B family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane and Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab153530 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up