Overview

  • Product name
    Recombinant Human SPPL2a protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPP VGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSE
    • Amino acids
      31 to 129
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.4.99
    • IMP3
    • Intramembrane protease 3
    • Presenilin like protein 2
    • PSL2
    • Signal peptide peptidase like 2A
    • SPP like 2A protein
    see all
  • Relevance
    This protein, which may act as an intramembrane protease, contains an N-terminal protease-associated (PA) domain, several transmembrane regions, a hydrophilic loop, conservative sequences around the first and second aspartate residues, and an invariant PAL motif near the C terminus.
  • Cellular localization
    Cell Membrane; multi-pass membrane protein

Images

  • ab164680 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up